Analytical Data
-
Gene name
Gzmc
- Application
-
Alternative Names
Gzmc；
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08882
-
Expression Region
21-248aa
-
AA Sequence
IIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHCKGSSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECYVAGWGKVTPDGEFPKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDSKIKGASFEEDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWIKKTMKHS
-
Molecular Weight
32.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Gzmc, also known as Granzyme C, is a serine protease predominantly expressed in cytotoxic T lymphocytes and natural killer (NK) cells, and plays a pivotal role in the immune response by facilitating the apoptosis of target cells, particularly virally infected and tumor cells. Research on Gzmc recombinant proteins has gained momentum due to their potential applications in cancer immunotherapy and viral infections. The mechanism by which Gzmc induces apoptosis involves the cleavage of specific substrates within the target cell, leading to programmed cell death. Understanding the structural and functional properties of Gzmc through recombinant protein studies can enhance our comprehension of its enzymatic activity, substrate specificity, and the overall role in the immune system. Furthermore, the ability to produce Gzmc in a recombinant form allows for detailed biochemical analyses and the development of novel therapeutic strategies aimed at augmenting immune responses in various disease contexts. The exploration of Gzmc’s role in the immune landscape is crucial, as it provides insight into potential biomarkers for disease progression and therapeutic targets, particularly in the field of oncology. Consequently, the study of Gzmc recombinant proteins holds significant promise for advancing our understanding of immune mechanisms and developing innovative treatments that harness the body’s natural defense systems.
