Analytical Data
-
Gene name
CD15
- Application
-
Alternative Names
CD15;CD83 antigen
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01151
-
Expression Region
1-205aa
-
AA Sequence
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD15, also known as Lewis X, is a carbohydrate antigen expressed on the surface of human cells, particularly prominent in granulocytes and some tissues of the immune system. It plays a crucial role in various biological processes, including cell adhesion, migration, and immune response modulation. Research on CD15 has gained significant attention due to its involvement in inflammatory responses and its potential role in cancer biology, where it may affect tumor cell behavior and metastasis. The presentation of CD15 on leukocytes has made it a valuable marker in the diagnosis and monitoring of certain hematological malignancies, including acute myeloid leukemia and chronic lymphocytic leukemia. The development of recombinant CD15 proteins has opened new avenues for understanding its functional mechanisms and interactions in vitro and in vivo, paving the way for therapeutic applications. By generating specific antibodies against CD15, researchers hope to harness the protein’s properties for targeted therapies, immunotherapeutics, and diagnostic tools. Investigating the structure-function relationship of recombinant CD15 proteins will also enhance our understanding of its role in immune evasion and establish a foundation for innovative strategies in the treatment of cancer and inflammatory diseases. Overall, the study of CD15 and its recombinant forms holds promise for advancing our knowledge of immunology and oncology, potentially leading to improved clinical outcomes for patients.











