Analytical Data
-
Gene name
GSTA4
- Application
-
Alternative Names
GSTA4;Glutathione S-transferase A4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15217
-
Expression Region
1-222aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAARPKLHYPNGRGRMESVRWVLAAA GVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIA DKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQ KAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILS AFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Glutathione S-transferase A4 (GSTA4) is an important enzyme involved in the detoxification of reactive electrophiles, playing a crucial role in the cellular defense mechanism against oxidative stress and xenobiotic compounds. This enzyme catalyzes the conjugation of glutathione to various harmful substrates, thereby facilitating their excretion. Research into GSTA4 has garnered significant attention due to its implications in various disease states, including cancer, neurodegenerative disorders, and inflammation. Dysregulation of GSTA4 expression and activity is often associated with increased susceptibility to toxic agents and the progression of diseases. Moreover, GSTA4 polymorphisms have been linked to individual variations in drug metabolism and therapeutic responses. Recombinant GSTA4 proteins are being extensively studied to elucidate their structural and functional characteristics, enabling the discovery of potential inhibitors or activators that could be used in therapeutic approaches. The recombinant production of GSTA4 allows for detailed biochemical studies and the development of novel strategies to modulate its activity, thereby providing insights into its biological significance and therapeutic potential. By exploring the role of GSTA4 in biological systems through recombinant technology, researchers aim to enhance the understanding of its involvement in pathophysiological processes and to identify novel therapeutic targets for intervention in related diseases. This growing body of research emphasizes the importance of GSTA4 not only in detoxification pathways but also in broader metabolic contexts, underscoring its potential as a biomarker and a target for drug development.
