Analytical Data
-
Gene name
GREM1
- Application
-
Alternative Names
GREM1;CKTSF1B1;DAND2;DRM;Gremlin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60565
-
Expression Region
25-184aa
-
AA Sequence
KKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGRGQGRGTAMPGEEVL ESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNS FYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVK QCRCISIDLD
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GREM1, or Gremlin 1, is a member of the Bone Morphogenetic Protein (BMP) antagonist family and plays a crucial role in various biological processes, including embryonic development, tissue regeneration, and disease pathology. Research has shown that GREM1 is involved in the regulation of cellular differentiation and proliferation, particularly in the context of bone and cartilage formation. Its aberrant expression has been implicated in several conditions, including cancer progression, where it may promote tumorigenesis by modulating the tumor microenvironment and enhancing metastatic potential. Additionally, GREM1's role in signaling pathways that influence stem cell behavior has led to interest in its potential therapeutic applications. The production of recombinant GREM1 protein has become essential for elucidating its complex biological functions and interactions in vitro and in vivo. By utilizing recombinant technology, researchers can obtain high-purity GREM1 for functional assays, structural studies, and the development of novel therapies targeting GREM1-related pathways. Understanding the molecular mechanisms mediated by GREM1 could provide insights into its potential as a biomarker for disease and a target for innovative treatments, thereby enhancing our knowledge of developmental biology and disease mechanisms.
