Analytical Data
-
Gene name
T899I
- Application
-
Alternative Names
T899I；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15393
-
Expression Region
819-1217aa
-
AA Sequence
MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNIGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF
-
Molecular Weight
52.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The T899I variant in the gene encoding the voltage-gated sodium channel NaV1.5 (SCN5A) has garnered significant attention in the field of molecular cardiology and pharmacology due to its association with various arrhythmogenic conditions, including Brugada syndrome and familial cardiac conduction disorders. This particular mutation results in a single amino acid substitution that alters the ion channel's functionality, potentially leading to abnormal cardiac electrical activity. Research into T899I recombinant protein aims to elucidate the mechanistic pathways by which this variant influences sodium channel kinetics and cardiac action potentials, providing insights into the molecular basis of associated pathologies. Utilizing recombinant protein expression techniques allows for in-depth analysis of the biophysical properties of T899I, including its ion conduction, gating behavior, and response to pharmacological agents. Through this research, scientists hope to identify therapeutic targets for intervention in patients carrying the T899I mutation and develop personalized medicine approaches to mitigate the risk of life-threatening arrhythmias. Understanding the implications of T899I at the molecular level could further enhance diagnostic strategies and treatment options for individuals suffering from heritable heart conditions.
