Analytical Data
-
Gene name
CXCR5
- Application
-
Alternative Names
CXCR5；BLR1；MDR15；C-X-C chemokine receptor type 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32302
-
Expression Region
1-55aa
-
AA Sequence
MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVP
-
Molecular Weight
19.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCR5, a C-X-C chemokine receptor, plays a critical role in immune response by directing B cells and T follicular helper cells to germinal centers in lymphoid tissues. Its ligand, CXCL13, is essential for the organization of these immune cells, thereby influencing antibody production and the formation of B cell follicles. Research has shown that CXCR5 is involved in various pathological conditions, including autoimmune diseases, chronic infections, and cancers. The study of CXCR5 recombinant proteins has gained momentum as they can serve as valuable tools for understanding the receptor's signaling pathways and interactions in greater detail. Moreover, the potential of CXCR5-targeted therapies for modulating immune responses has sparked interest in the development of CXCR5 antagonists or agonists. By producing and characterizing CXCR5 recombinant proteins, researchers aim to elucidate their precise roles in immune regulation and identify novel therapeutic strategies that harness or inhibit CXCR5 pathways, ultimately contributing to improved treatment options for diseases characterized by dysregulated immune responses. This ongoing research underscores the significance of CXCR5 in both basic immunology and translational medicine.
