Analytical Data
-
Gene name
FAM72A
- Application
-
Alternative Names
FAM72A；UGENE；Protein FAM72A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TYM5
-
Expression Region
1-149aa
-
AA Sequence
MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR
-
Molecular Weight
20.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM72A, a member of the FAM72 gene family, has garnered attention in recent years due to its potential role in various biological processes, including cell proliferation, DNA damage response, and tumorigenesis. Research indicates that FAM72A is involved in cellular stress responses and may contribute to the maintenance of genome stability. Its expression is often upregulated in different cancer types, suggesting a possible link between FAM72A and oncogenic pathways. Studies utilizing recombinant FAM72A protein have provided insights into its functional mechanisms, including protein-protein interactions and its influence on the cell cycle. The investigation of FAM72A through recombinant techniques has enabled researchers to explore its biochemical properties and cellular functions in greater detail, facilitating the identification of potential therapeutic targets. Understanding the precise role of FAM72A in cancer biology may lead to novel strategies for diagnosis and treatment, highlighting its significance as a focal point in cancer research. Current studies aim to delineate the molecular pathways associated with FAM72A, potentially paving the way for its application in clinical settings.
