Analytical Data
-
Gene name
GRAP2
- Application
-
Alternative Names
GRAP2;GADS;GRB2L;GRID;GRB2-related adapter Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75791
-
Expression Region
1-330aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMEAVAKFDFTASGEDELSFHTGDVLKILSN QEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFF IIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVD YYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP SMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQ ERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALY DFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRAP2 (Grb2-related adapter protein 2) is a member of the GRB2 family of proteins, playing a crucial role in signal transduction pathways that mediate various cellular processes, including proliferation, differentiation, and survival. It acts as an adaptor protein, facilitating the interaction between receptor tyrosine kinases and downstream signaling molecules. The study of GRAP2 recombinant protein has garnered interest due to its potential implications in cancer biology and therapeutic interventions. Abnormal expression or function of GRAP2 has been associated with various malignancies, highlighting the need to understand its biological roles further. Researchers have sought to produce recombinant GRAP2 to investigate its structural properties, signaling mechanisms, and interactions with other proteins. These studies often involve techniques such as molecular cloning, expression in different host systems, and purification methods, which enable detailed characterization of GRAP2. The insights gained from this research could provide a foundation for developing targeted therapies that modulate GRAP2 activity, potentially leading to innovative strategies for cancer treatment. Overall, the exploration of GRAP2 recombinant protein serves as a critical stepping stone toward unraveling its functional significance in cellular signaling and its potential as a therapeutic target.
