Cat: PA2000-94DB

Recombinant Human CRF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CRF;Corticoliberin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06850

  • Expression Region

    43-196aa

  • AA Sequence

    LDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSL LAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGG HQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEI IGK

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Corticotropin-releasing factor (CRF) is a vital peptide hormone involved in the regulation of the hypothalamic-pituitary-adrenal (HPA) axis and plays a significant role in the body’s response to stress. The exploration of CRF and its recombinant forms has garnered attention in the fields of neuroscience, endocrinology, and pharmacology due to its implications in various psychiatric disorders such as anxiety, depression, and post-traumatic stress disorder (PTSD). Understanding CRF’s structure and function is crucial for developing targeted therapies aimed at modulating stress responses and treating related conditions. The recombinant technology allows for the production of CRF proteins in a controlled manner, facilitating detailed studies of their biological functions and interactions at the molecular level. These studies also assist in the identification of CRF receptor subtypes, which have become potential drug targets. Additionally, the development of CRF-based recombinant proteins has the potential to advance therapeutic strategies, providing insights into the mechanisms of stress-related disorders. Overall, CRF recombinant proteins represent a significant biotechnological advancement, reflecting the convergence of molecular biology, biochemistry, and clinical research in the quest to mitigate stress-related health issues.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US