Analytical Data
-
Gene name
CRF
- Application
-
Alternative Names
CRF;Corticoliberin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06850
-
Expression Region
43-196aa
-
AA Sequence
LDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSL LAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGG HQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEI IGK
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Corticotropin-releasing factor (CRF) is a vital peptide hormone involved in the regulation of the hypothalamic-pituitary-adrenal (HPA) axis and plays a significant role in the body’s response to stress. The exploration of CRF and its recombinant forms has garnered attention in the fields of neuroscience, endocrinology, and pharmacology due to its implications in various psychiatric disorders such as anxiety, depression, and post-traumatic stress disorder (PTSD). Understanding CRF’s structure and function is crucial for developing targeted therapies aimed at modulating stress responses and treating related conditions. The recombinant technology allows for the production of CRF proteins in a controlled manner, facilitating detailed studies of their biological functions and interactions at the molecular level. These studies also assist in the identification of CRF receptor subtypes, which have become potential drug targets. Additionally, the development of CRF-based recombinant proteins has the potential to advance therapeutic strategies, providing insights into the mechanisms of stress-related disorders. Overall, CRF recombinant proteins represent a significant biotechnological advancement, reflecting the convergence of molecular biology, biochemistry, and clinical research in the quest to mitigate stress-related health issues.











