Cat: PA2000-8302

Recombinant Human HNRPDL Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HNRPDL

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    A+U-rich element RNA binding factor; AA407431; AA959857; AU rich element RNA binding factor; AU-rich element RNA-binding factor; D5Ertd650e; D5Wsu145e; Heterogeneous nuclear ribonucleoprotein D like; Heterogeneous nuclear ribonucleoprotein D like protein; Heterogeneous nuclear ribonucleoprotein D-like; hnHNRP DL; HNRDL_HUMAN; HNRNP; hnRNP D-like; hnRNP DL; HNRNPDL; hnRPD like protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14979

  • Expression Region

    1-420aa

  • AA Sequence

    MEVPPRLSHVPPPLFPSAPATLASRSLSHWRPRPPRQLAPLLPSLAPSSARQGARRAQRHVTAQQPSRLAGGAAIKGGRRRRPDLFRRHFKSSSIQRSAAAAAATRTARQHPPADSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY

  • Molecular Weight

    72.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HNRPDL, or heterogeneous nuclear ribonucleoprotein D-like, is a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) family, which plays a crucial role in RNA metabolism, including splicing, transport, and stability. Research into HNRPDL has garnered attention due to its involvement in key cellular processes and its potential implications in various diseases, particularly cancer. Dysregulation of hnRNP proteins, including HNRPDL, has been linked to the aberrant expression of genes associated with tumor progression and metastasis. Studies have shown that HNRPDL participates in the regulation of pre-mRNA splicing, impacting the production of mRNA variants that may contribute to oncogenic pathways. Furthermore, its expression levels have been correlated with patient prognosis in several malignancies, suggesting that HNRPDL may serve as a potential biomarker for cancer diagnosis or therapy. The reconstitution of HNRPDL as a recombinant protein offers a vital tool for understanding its biochemical properties, interactions, and functional roles in RNA processing. This research is crucial for elucidating the mechanisms by which HNRPDL influences gene expression and contributes to disease states, and for exploring its potential as a therapeutic target or diagnostic marker in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US