Cat: PA1000-1308

Recombinant Human GOT2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GOT2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GOT2;KYAT4;Aspartate aminotransferase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P00505

  • Expression Region

    30-430aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSSSWWTHVEMGPPDPILGVTEAFKRDTN SKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFC KASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVF LPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSV LLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDK DAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVES QLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRT QLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDG RISVAGVTSSNVGYLAHAIHQVTK

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GOT2 (Glutamate Oxidoreductase 2) is a vital enzyme involved in the mitochondrial pathway of amino acid metabolism, primarily responsible for the reversible conversion of L-aspartate and α-ketoglutarate to L-glutamate and oxaloacetate. This enzyme plays a crucial role in the cellular metabolism and energy production within mitochondria, impacting various physiological processes such as neurotransmitter regulation and nitrogen metabolism. The significance of GOT2 has been highlighted in the context of various diseases, including neurodegenerative disorders and cancers, where its expression levels and activity can be altered. Researchers are keenly investigating the potential of GOT2 as a therapeutic target and biomarker due to its involvement in metabolic pathways that are often dysregulated in pathological conditions. The development of recombinant GOT2 proteins allows for in-depth studies of its biochemical properties, interaction with inhibitors, and role in metabolic flux, enabling scientists to elucidate its function and regulatory mechanisms in health and disease. Such studies hold promise for advancing our understanding of mitochondrial dysfunction and developing novel therapeutic strategies aimed at restoring normal metabolic processes. Overall, the ongoing research into recombinant GOT2 not only expands our basic understanding of mitochondrial metabolism but also paves the way for innovative approaches to target metabolic diseases effectively.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US