Analytical Data
-
Gene name
PODXL
- Application
-
Alternative Names
PODXL;PCLP;PCLP1;Podocalyxin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00592
-
Expression Region
32-458aa
-
AA Sequence
QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF
-
Molecular Weight
46.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PODXL (Podocalyxin-like protein) is a member of the CD34 family of sialomucins and plays crucial roles in various biological processes, including cell adhesion, migration, and signaling. Initially identified in renal podocytes, PODXL has also been implicated in cancer biology, specifically in tumor progression and metastasis. Its expression is upregulated in several malignancies, making it a potential biomarker for poor prognosis and a target for therapeutic interventions. Research into the recombinant expression of PODXL aims to elucidate its functional mechanisms, particularly in how it modulates cellular interactions within the tumor microenvironment. By producing PODXL in a recombinant system, scientists can study its structural properties, glycosylation patterns, and interactions with other proteins, paving the way for the development of diagnostic tools and novel therapeutic strategies. Understanding PODXL's role in both physiological and pathophysiological contexts is vital for advancing cancer research and improving treatment options for patients.











