Analytical Data
-
Gene name
ccmK2
- Application
-
Alternative Names
ccmK2;ccmK;ccmK1;Carboxysome shell Protein CcmK2
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P72761
-
Expression Region
2-103aa
-
AA Sequence
SIAVGMIETRGFPAVVEAADSMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVSAGIEAANRVNGGEVLSTHIIARPHENLEYVLPIRYTEEVEQFRTY
-
Molecular Weight
18.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of recombinant proteins, particularly the ccmK2 protein, has gained significant attention due to its potential applications in various fields, including biotechnology and synthetic biology. CcmK2 is a component of the phototrophic bacterium *Rhodobacter sphaeroides* and is involved in the assembly of the photosynthetic apparatus, specifically within the complex process of chlorosome formation. Chlorosomes are essential for harvesting light energy in photosynthetic organisms, making the understanding of ccmK2 crucial for advancements in bioenergy and renewable resources. Additionally, research into the ccmK2 protein can provide insights into microbial metabolic pathways, which could be harnessed for industrial processes such as bioremediation and the production of biofuels. Furthermore, the recombinant expression of ccmK2 allows for the exploration of its structural and functional characteristics, contributing to a deeper understanding of protein interactions within cellular environments. As the demand for sustainable energy solutions grows, the exploration of proteins like ccmK2 may offer innovative strategies for enhancing the efficiency of photosynthetic systems and developing new technologies that leverage biological processes for energy conversion and storage.











