Analytical Data
-
Gene name
GNRH1
- Application
-
Alternative Names
GNRH1;GNRH;GRH;LHRH;Progonadoliberin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01148
-
Expression Region
1-92aa
-
AA Sequence
MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVK EVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GNRH1, or Gonadotropin-Releasing Hormone 1, plays a pivotal role in the regulation of the reproductive hormone axis in mammals. It is synthesized in the hypothalamus and is responsible for stimulating the pituitary gland to release two key hormones: luteinizing hormone (LH) and follicle-stimulating hormone (FSH), which are crucial for gonadal function and fertility. The study of GNRH1 recombinant proteins has gained attention in recent years due to their potential applications in reproductive health and disease management. For instance, abnormalities in GNRH1 signaling can lead to various reproductive disorders, including hypogonadism, precocious puberty, and reproductive cancers. By generating recombinant GNRH1 proteins, researchers aim to explore the molecular mechanisms underlying these conditions and to develop targeted therapies. Additionally, these proteins can serve as valuable tools for understanding the intricate hormonal feedback loops involved in the endocrine system. Advances in biotechnology enable the production of high-purity GNRH1, facilitating in-depth studies of its structure-function relationships and interactions with GNRH receptors. This research not only enhances our understanding of reproductive physiology but also holds promise for innovative clinical interventions in fertility treatment and hormonal disorders. Overall, the investigation of GNRH1 recombinant proteins represents a significant frontier in endocrinology and reproductive medicine, with the potential to contribute to new therapeutic strategies and enhance reproductive health outcomes.











