Analytical Data
-
Gene name
HMP19
- Application
-
Alternative Names
HMP19; Neuron-specific protein family member 2; Nsg2; NSG2_HUMAN; Protein p19
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y328
-
Expression Region
1-171aa
-
AA Sequence
MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH
-
Molecular Weight
44.55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HMP19, a recombinant protein derived from the heat-shock protein family, has garnered significant attention in the field of biomedical research due to its potential implications in cellular stress responses and disease mechanisms. This protein has been linked to various cellular functions, including chaperoning misfolded proteins, regulating apoptosis, and mediating inflammatory responses. Notably, HMP19 has been implicated in the pathogenesis of several diseases, including cancers and neurodegenerative disorders, where its expression levels may influence disease progression and prognosis. As a result, understanding the structure, function, and regulatory mechanisms of HMP19 is crucial for developing therapeutic strategies. Recent studies have focused on elucidating its role in modulating cellular pathways and its interaction with other proteins, with the aim of identifying novel biomarkers for disease diagnosis and treatment. Furthermore, the generation of recombinant HMP19 offers a platform for investigating its biophysical properties and potential as a therapeutic target. Overall, HMP19 represents a promising avenue for research that not only enhances our understanding of fundamental biological processes but also opens new avenues for clinical applications in treating stress-related diseases.
