Analytical Data
-
Gene name
GMF
- Application
-
Alternative Names
GMFG;Glia maturation factor gamma
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60983
-
Expression Region
1-142aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNA AIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDG RVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLT EEWLREKLGFFH
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GMF (Glial Maturation Factor) protein is a crucial player in the modulation of glial cell maturation and function within the central nervous system. Research into GMF and its recombinant variants has gained momentum due to its potential neuroprotective roles and implications in various neurological disorders. Originally identified as a molecule involved in the differentiation and maturation of astrocytes, GMF has been shown to influence neuroinflammatory processes and neuronal survival. Its unique structure and ability to interact with specific signaling pathways make it a compelling target for therapeutic interventions. Recombinant GMF proteins are being explored for their effects on neural repair mechanisms, particularly in the context of neurodegenerative diseases such as Alzheimer's and multiple sclerosis. Additionally, studies are increasingly focusing on the modulation of GMF activity to harness its protective effects against neuroinflammation and to promote recovery following traumatic brain injury. Understanding the functional dynamics of GMF, especially through recombinant technology, is essential for developing innovative strategies aimed at enhancing neural resilience and promoting effective recovery in the face of neurological damage. With ongoing advancements in molecular biology techniques, GMF's potential as a biomarker for glial activity and a therapeutic agent continues to be a fertile ground for research, promising new insights into brain health and disease management.
