Cat: PA1000-1278

Recombinant Human GMF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GMF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GMFG;Glia maturation factor gamma

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P60983

  • Expression Region

    1-142aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNA AIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDG RVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLT EEWLREKLGFFH

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GMF (Glial Maturation Factor) protein is a crucial player in the modulation of glial cell maturation and function within the central nervous system. Research into GMF and its recombinant variants has gained momentum due to its potential neuroprotective roles and implications in various neurological disorders. Originally identified as a molecule involved in the differentiation and maturation of astrocytes, GMF has been shown to influence neuroinflammatory processes and neuronal survival. Its unique structure and ability to interact with specific signaling pathways make it a compelling target for therapeutic interventions. Recombinant GMF proteins are being explored for their effects on neural repair mechanisms, particularly in the context of neurodegenerative diseases such as Alzheimer's and multiple sclerosis. Additionally, studies are increasingly focusing on the modulation of GMF activity to harness its protective effects against neuroinflammation and to promote recovery following traumatic brain injury. Understanding the functional dynamics of GMF, especially through recombinant technology, is essential for developing innovative strategies aimed at enhancing neural resilience and promoting effective recovery in the face of neurological damage. With ongoing advancements in molecular biology techniques, GMF's potential as a biomarker for glial activity and a therapeutic agent continues to be a fertile ground for research, promising new insights into brain health and disease management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US