Analytical Data
-
Gene name
HIST1H3E
- Application
-
Alternative Names
H3 histone family member E pseudogene; H3 histone family; member A; H3/A; H31_HUMAN; H3F3; H3FA; Hist1h3a ; HIST1H3B; HIST1H3C; HIST1H3D; HIST1H3E; HIST1H3F; HIST1H3G; HIST1H3H; HIST1H3I; HIST1H3J; HIST3H3; histone 1; H3a ; Histone cluster 1; H3a; Histone H3 3 pseudogene; Histone H3.1; Histone H3/a; Histone H3/b
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P68431
-
Expression Region
1-136aa
-
AA Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
-
Molecular Weight
40.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST1H3E is a gene encoding the histone H3 variant, which plays a crucial role in the structural organization of chromatin and regulation of gene expression. This protein is part of the histone family, specifically contributing to the formation of nucleosomes—complexes of DNA and histones that package DNA into a compact, dense shape, allowing it to fit within the nucleus of cells. Variations in histone proteins, including HIST1H3E, have been implicated in various biological processes, such as cell differentiation, proliferation, and response to environmental stimuli. Moreover, alterations in histone variant expression are associated with several diseases, including cancer, highlighting the significance of understanding HIST1H3E's function and its potential as a therapeutic target. Recent studies have focused on the biochemical properties of the HIST1H3E protein, investigating how its specific modifications, such as methylation or acetylation, affect chromatin dynamics and, consequently, gene regulation. Understanding these mechanisms is essential for unraveling the complex regulatory networks that govern cellular behavior and development. Given its pivotal role in chromatin architecture and gene expression modulation, HIST1H3E serves as a valuable model for deciphering the intricacies of epigenetic regulation and its implications in health and disease. Researchers are now exploring innovative approaches to manipulate HIST1H3E expression and functionality with the hope of revealing new pathways for therapeutic intervention, particularly in cancer and other epigenetic-related disorders.
