Analytical Data
-
Gene name
RPGR
- Application
-
Alternative Names
RPGR；RP3；XLRP3；X-linked retinitis pigmentosa GTPase regulator
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92834
-
Expression Region
54-367aa
-
AA Sequence
NKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAP
-
Molecular Weight
62.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RPGR (Retinitis Pigmentosa GTPase Regulator) is a gene essential for the normal functioning of photoreceptors in the retina. Mutations in RPGR are the leading cause of X-linked retinitis pigmentosa (XLRP), a hereditary eye disease that leads to progressive vision loss. Research on RPGR recombinant proteins is crucial for understanding the molecular mechanisms underlying this condition. Given RPGR's role in ciliary function and photoreceptor maintenance, scientists are exploring the structure and functional domains of the RPGR protein to elucidate its interactions with other cellular components. The focus on recombinant RPGR proteins enables researchers to produce and purify functional versions of the protein, facilitating studies on its biochemical properties and cellular pathways. These studies are pivotal for the development of potential therapeutic strategies, including gene therapy and small molecule interventions, aimed at restoring photoreceptor function and preserving vision in affected individuals. Progress in this area could lead to groundbreaking treatments for XLRP and related retinal degenerative diseases, ultimately improving the quality of life for patients suffering from these conditions.
