Analytical Data
-
Gene name
GAL7
- Application
-
Alternative Names
GAL7;Galactose-1-phosphate uridylyltransferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P47929
-
Expression Region
2-136aa
-
AA Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFSNVPHKSSLPEGIRPGTVLRI RGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGR EERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLV EVGGDVQLDSVRIF
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GAL7, or galactosidase 7, is a member of the glycoside hydrolase family that has garnered interest due to its potential applications in biotechnology and medicine. Initially identified in the context of yeast and filamentous fungi, GAL7 plays a critical role in the metabolism of galactose, a key carbohydrate for energy production. Research into GAL7 has expanded beyond its basic enzymatic functions, particularly its involvement in the degradation of complex carbohydrates, which is crucial for processes such as fermentation and bioconversion. The recombinant production of GAL7 protein offers a valuable tool for studying its biochemical properties and enzymatic mechanisms in detail. Advances in genetic engineering have enabled the expression of GAL7 in various heterologous systems, allowing for improved yield and activity of the protein. Characterization of recombinant GAL7 can contribute to the development of more efficient biocatalysts for industrial applications, including biofuel production and waste management. Furthermore, understanding its structure and function could also pave the way for therapeutic interventions targeting metabolic disorders related to galactose. Overall, the study of GAL7 recombinant protein is an essential area of research that bridges basic science with practical applications in biotechnology and health.











