Analytical Data
-
Gene name
HIST1H2AI
- Application
-
Alternative Names
HIST1H2AH; HIST1H2AI; Histone H2A type 1-H; Histone H2A/s
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96KK5
-
Expression Region
1-130aa
-
AA Sequence
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
-
Molecular Weight
14.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST1H2AI is a critical member of the histone H2A family, primarily involved in the packaging and regulation of DNA in eukaryotic cells. Histone proteins play a fundamental role in chromatin structure and gene expression, influencing various cellular processes, including cell division, DNA repair, and gene activation. Research on HIST1H2AI specifically focuses on its role in epigenetic regulation, which is essential for understanding numerous biological mechanisms and disease pathways, such as cancer. The recombinant expression of HIST1H2AI allows researchers to study its structure, function, and interactions with other molecular players within the chromatin environment. Furthermore, recombinant HIST1H2AI provides a valuable tool for investigating the effects of post-translational modifications on histone dynamics and their subsequent impact on gene regulation. By elucidating the functional roles of HIST1H2AI, scientists aim to uncover its contributions to chromatin remodeling and cellular signaling pathways, ultimately seeking to identify potential therapeutic targets for diseases associated with chromatin dysregulation. In summary, the study of HIST1H2AI recombinant proteins not only enhances our comprehension of histone biology but also opens new avenues for therapeutic interventions in the context of epigenetic diseases.
