Cat: PA1000-1254

Recombinant Human GLOD4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GLOD4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GLOD4;C17orf25;Glyoxalase domain-containing Protein 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HC38-2

  • Expression Region

    1-298aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAARRALHFVFKVGNRFQTARFYRDVLGMK VLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDY KLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNR SLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADN QCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLV SLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMA ADKSDEWFAKHNKPKASG

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GLOD4, also known as GLutathione-dependent Oxidoreductase Domain 4, is a member of the glutathione peroxidase family, which plays a crucial role in cellular processes by reducing reactive oxygen species (ROS) and maintaining redox homeostasis. The significance of GLOD4 has been increasingly recognized in the context of various diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases, where oxidative stress is often implicated. The protein's unique structure and enzymatic properties make it a potential target for therapeutic intervention. Recent studies have revealed that GLOD4 is involved in regulating cell proliferation, apoptosis, and inflammation, indicating its multifaceted role in health and disease. Understanding the biological function of GLOD4, particularly through the development of recombinant protein for biochemical assays, allows researchers to elucidate its mechanism of action and explore its potential as a biomarker or therapeutic target. As such, the investigation into GLOD4's structure, function, and interactions at the molecular level has become an important area of research, with implications for developing novel strategies to mitigate oxidative stress-related pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US