Analytical Data
-
Gene name
COR410
- Application
-
Alternative Names
COR410；Dehydrin COR410
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P46524
-
Expression Region
1-262aa
-
AA Sequence
MEDERSTQSYQGGEAAEQVEVTDRGLLGNLLGKKKAEEDKEKEEELVTGMEKVSVEEPEVKKEEHEDGEKKETLFSKLHRSSSSSSSSSDEEEEEVIDDNGEVIKRKKKKGLKEKLQGKLPGHKDTEGEHVTGLPAPAAPASVQTHGGHHDTDVVVEKIDGDVKTEAAPAVPEEEKKGFLEKIKEKLPGGHKKPEDAAAVPVTHAAPAPVHAPVPAPEEVSSPDAKEKKGLLGKIMDKLPGYHKTGEEDKAAAATGEHKPSA
-
Molecular Weight
31.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COR410 is a recombinant protein that has garnered significant interest in the field of biopharmaceutical research, particularly due to its potential role in the treatment of various diseases. The study of COR410 is rooted in the growing need for effective therapeutic agents that can target specific molecular pathways involved in disease progression. Recent advances in protein engineering and biotechnology have enabled the design and production of recombinant proteins with enhanced efficacy and safety profiles. COR410, in particular, is being investigated for its applications in conditions such as cancer and inflammatory disorders, where traditional treatments often fall short. Researchers are focusing on elucidating its mechanisms of action, optimizing production processes, and evaluating its pharmacokinetics and pharmacodynamics. The development of COR410 not only represents a promising therapeutic avenue but also highlights the importance of recombinant proteins in modern medicine, as they offer the potential for tailored treatments based on individual patient profiles and disease characteristics. As ongoing studies continue to reveal the functional properties of COR410, it could pave the way for novel therapeutic strategies, ultimately improving patient outcomes and advancing the field of targeted therapy.
