Analytical Data
-
Gene name
HGSNAT
- Application
-
Alternative Names
HGSNAT; TMEM76; Heparan-alpha-glucosaminide N-acetyltransferase; EC 2.3.1.78; Transmembrane protein 76
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q68CP4
-
Expression Region
1-206aa
-
AA Sequence
MALGLCRCFHPRHSMAAFGLFPALPSALNSHPACTCLLDPSTWRPAHVSGPALASSPQILSVFSLGFPGFVNGSCVSRYKPDIIFPPGLPPPDLPSSVSIFYLQLLCSHGHCCITESGPLLSFSNWPPSLVPHFLKSPVHCHQIKLSPARSPLSEKPPLTWKHHCLAHILTYSPSRLDPHTSFQPPLPLHSLLPPPPPHPLVSPPL
-
Molecular Weight
48.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HGSNAT (Heparan-alpha-glucosaminide N-acetyltransferase) is a key enzyme involved in the lysosomal degradation of heparan sulfate, a crucial glycosaminoglycan that plays significant roles in cellular communication, adhesion, and development. Mutations in the HGSNAT gene lead to a rare lysosomal storage disorder known as mucopolysaccharidosis type III (MPS III), or Sanfilippo syndrome, characterized by neurodegeneration and various developmental abnormalities. The study of recombinant HGSNAT protein is essential for understanding its structure-function relationships and the molecular mechanisms underlying its enzymatic activity. Furthermore, producing this enzyme through recombinant techniques allows for the investigation of potential therapeutic interventions, particularly enzyme replacement therapies that could ameliorate or halt the progression of MPS III in affected individuals. Additionally, exploring HGSNAT's interactions with substrates or other cellular components could provide insights into the broader implications of heparan sulfate metabolism in health and disease. As research progresses, recombinant HGSNAT may serve not only as a pivotal model for biochemical studies but also as a promising candidate for innovative treatment strategies for lysosomal storage disorders and related conditions.
