Cat: PA2000-4081

Recombinant Human nblA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    nblA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    nblA;Phycobilisome degradation Protein NblA

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35087

  • Expression Region

    1-59aa

  • AA Sequence

    MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

  • Molecular Weight

    14.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NblA, or "Nitrile-Utilizing Bacterial Lipoprotein A," is a protein that has garnered significant interest in the fields of molecular biology and biotechnology due to its potential applications in bioremediation and industrial processes. It is derived from various bacterial strains that possess the ability to metabolize nitrile compounds, which can be harmful environmental pollutants. The study of NblA is crucial as it plays a vital role in the degradation of these compounds, leading to the development of environmentally friendly strategies for detoxifying contaminated sites. Research has focused on understanding the protein's structure, function, and the underlying mechanisms of nitrile degradation, which could pave the way for its applications in creating engineered microorganisms capable of efficiently breaking down pollutants. Moreover, by exploring the recombinant production of NblA, scientists aim to enhance its availability for various experimental and industrial uses. This recombinant form can be optimized for increased stability and activity, enabling the protein to be utilized in more controlled and efficient remediation processes. As environmental concerns regarding nitrile contamination continue to rise, the study of NblA and its recombinant protein form is positioned at the forefront of efforts to harness biological solutions for sustainable environmental management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US