Analytical Data
-
Gene name
nblA
- Application
-
Alternative Names
nblA；Phycobilisome degradation Protein NblA
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35087
-
Expression Region
1-59aa
-
AA Sequence
MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS
-
Molecular Weight
14.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NblA, or "Nitrile-Utilizing Bacterial Lipoprotein A," is a protein that has garnered significant interest in the fields of molecular biology and biotechnology due to its potential applications in bioremediation and industrial processes. It is derived from various bacterial strains that possess the ability to metabolize nitrile compounds, which can be harmful environmental pollutants. The study of NblA is crucial as it plays a vital role in the degradation of these compounds, leading to the development of environmentally friendly strategies for detoxifying contaminated sites. Research has focused on understanding the protein's structure, function, and the underlying mechanisms of nitrile degradation, which could pave the way for its applications in creating engineered microorganisms capable of efficiently breaking down pollutants. Moreover, by exploring the recombinant production of NblA, scientists aim to enhance its availability for various experimental and industrial uses. This recombinant form can be optimized for increased stability and activity, enabling the protein to be utilized in more controlled and efficient remediation processes. As environmental concerns regarding nitrile contamination continue to rise, the study of NblA and its recombinant protein form is positioned at the forefront of efforts to harness biological solutions for sustainable environmental management.
