Analytical Data
-
Gene name
HERC3
- Application
-
Alternative Names
HERC3; KIAA0032Probable E3 ubiquitin-protein ligase HERC3; EC 2.3.2.26; HECT domain and RCC1-like domain-containing protein 3; HECT-type E3 ubiquitin transferase HERC3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IXX3
-
Expression Region
232-358aa
-
AA Sequence
SPCHVKLLRTQKVVYISCGEEHTAVLTKSGGVFTFGAGSCGQLGHDSMNDEVNPRRVLELMGSEVTQIACGRQHTLAFVPSSGLIYAFGCGARGQLGTGHTCNVKCPSPVKGYWAAHSGQLSARADR
-
Molecular Weight
117 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HERC3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3) is a member of the HECT E3 ubiquitin ligase family, which plays a critical role in post-translational modification processes by ubiquitination, impacting protein stability and cellular functions. The study of HERC3 has garnered attention due to its involvement in various physiological and pathological processes, including immune response regulation, cell proliferation, and apoptosis. Research indicates that aberrant expression or dysfunction of HERC3 may contribute to diverse diseases, such as cancer and neurodegenerative disorders. Understanding HERC3's mechanisms can reveal important insights into these pathologies and highlight potential therapeutic targets. Recent studies utilizing recombinant HERC3 proteins have aimed to elucidate its substrate specificity, interaction networks, and functional roles within the cell, thus paving the way for advancements in targeted therapies. The generation of recombinant HERC3 also facilitates biomechanical assays and high-throughput screening, providing a platform for identifying novel inhibitors or modulators of HERC3 activity. Consequently, ongoing research into HERC3 and its recombinant forms represents a promising frontier in molecular biology, with implications for improving disease outcomes through therapeutic intervention.
