Analytical Data
-
Gene name
HEPN1
- Application
-
Alternative Names
HEPN1; Putative cancer susceptibility gene HEPN1 protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6WQI6
-
Expression Region
1-88aa
-
AA Sequence
MGNWGLGIAPWVDGESELEFRRLGMQGPLEALRRREWNTQRASFSFSFLIALSPHTVDYCHSYELFNRRWHGHVLATQRPSLFILMLV
-
Molecular Weight
36.08 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HEPN1 (HEP19) is a member of the Hepcidin family, known for its role in iron homeostasis and antimicrobial activity. The exploration of HEPN1 recombinant protein has garnered significant attention due to its potential therapeutic applications in various diseases, including anemia, inflammatory disorders, and infections. Recent studies have highlighted the importance of HEPN1 in regulating iron metabolism, making it a critical target for understanding and treating conditions associated with iron overload or deficiency. Additionally, HEPN1 exhibits antimicrobial properties that may hold promise for developing novel treatments against infections caused by resistant pathogens. The recombinant production of HEPN1 allows for detailed structural and functional studies, facilitating the elucidation of its mechanism of action and interaction with other proteins. Furthermore, the ability to produce HEPN1 in a high-yield, controlled environment offers advantages for both basic research and clinical applications, paving the way for biopharmaceutical development. Understanding the biological functions and therapeutic potential of HEPN1 is crucial for advancing knowledge in the fields of hematology, immunology, and infectious diseases. As research progresses, the recombinant protein may offer new insights into iron metabolism regulation and open avenues for innovative intervention strategies against related health issues.
