Analytical Data
-
Gene name
MDC
- Application
-
Alternative Names
MDC；MDC；SCYA22；C-C motif chemokine 22
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00626
-
Expression Region
25-93aa
-
AA Sequence
GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKE ICADPRVPWVKMILNKLSQ
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MDC (Monocyte-Derived Chemokine) recombinant protein research has gained significant attention due to its potential role in immune modulation and inflammatory responses. MDC is a cytokine that plays a crucial part in the migration and activation of immune cells, particularly monocytes, which are pivotal in the body's defense mechanisms. The recombinant production of MDC facilitates the investigation of its biological functions and therapeutic applications, especially in conditions such as chronic inflammation, autoimmune diseases, and cancer. The ability to produce MDC in a controlled and scalable manner allows researchers to study its signaling pathways, interactions with other immune mediators, and its effects on different cell types. Furthermore, understanding the mechanistic role of MDC in disease processes can pave the way for the development of novel therapeutic strategies targeting MDC pathways, with the potential to improve patient outcomes in various pathological conditions. As such, the study of MDC recombinant proteins is not only critical for advancing our knowledge of immune responses but also for exploring new avenues in immunotherapy and personalized medicine.
