Cat: PA1000-1214

Recombinant Human GDA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GDA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GDA;KIAA1258;Guanine deaminase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y2T3

  • Expression Region

    1-454aa

  • AA Sequence

    MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQ QEKLAKEWCFKPCEIRELSHHEFFMPGLVDTHIHASQYSFAGSSIDLPLL EWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTACYFATIHTDSS LLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEESIKETERFVSEMLQ KNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDEVEA VKNLYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAH CPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVS NILLINKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILI NPKASDSPIDLFYGDFFGDISEAVIQKFLYLGDDRNIEEVYVGGKQVVPF SSSV

  • Molecular Weight

    51 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GDA (Guanosine Diphosphate-L-aminobutyric Acid) is a recombinant protein that has garnered significant interest in biomedical research due to its potential therapeutic applications. The study of GDA is rooted in its role in cellular signaling pathways, particularly in the modulation of the immune response and its influence on metabolic processes. Researchers have identified GDA's involvement in various physiological functions, including neurotransmission and cell proliferation. The recombinant production of GDA allows for the generation of high-purity protein that can be utilized in in vitro and in vivo experiments, facilitating a better understanding of its biological functions and mechanisms. Advances in genetic engineering and protein expression technologies have enabled the production of GDA in various host systems, enhancing its accessibility for research purposes. Investigations into GDA's properties are paving the way for potential innovations in drug development, particularly in the treatment of immune-related disorders and metabolic diseases. Furthermore, the exploration of GDA's structure-function relationship through techniques such as X-ray crystallography and NMR spectroscopy holds promise for designing targeted therapeutics that could have significant clinical benefits. As the understanding of GDA continues to grow, the implications of its study may extend to various fields, including pharmacology, immunology, and biotechnology, making it a focal point in current scientific research endeavors.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US