Analytical Data
-
Gene name
GCSH
- Application
-
Alternative Names
GCSH;Glycine cleavage system H Protein. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23434
-
Expression Region
49-173aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMSVRKFTEKHEWVTTENGIGTVGISNF AQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEIN EALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GCSH (glycine cleavage system H-protein) is a crucial component in the glycine decarboxylase complex, playing a vital role in the catabolism of glycine, an important amino acid involved in several metabolic pathways. Recent studies have highlighted the significance of GCSH in various biological processes, including energy metabolism, neurotransmission, and development. The enzymatic activity of GCSH is linked to the generation of one-carbon units, which are essential for nucleotide biosynthesis and cellular methylation reactions. Understanding the structure and function of GCSH at the molecular level has garnered increasing interest, particularly in the context of its potential implications in metabolic disorders and diseases such as cancer. Additionally, the recombinant production of GCSH in various expression systems allows for in-depth functional assays and examination of its interactions within the glycine cleavage system. This research not only provides insights into the fundamental biological roles of GCSH but also paves the way for exploring therapeutic strategies targeting metabolic dysfunctions linked to glycine metabolism.
