Analytical Data
-
Gene name
C2orf69
- Application
-
Alternative Names
C2orf69;Mitochondrial Protein C2orf69
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N8R5
-
Expression Region
25-385aa
-
AA Sequence
SSCSQARTMNPGGSGGARCSLSAEVRRRQCLQLSTVPGADPQRSNELLLLAAAGEGLERQDLPGDPAKEEPQPPPQHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHNTDFGAFKHLYMLLVNAFNLSQNSLSKKSLNVWNKDSIASNCRSSPSHTTNGCQGEKVRTCEKSDESAMSFYPPSLNDASFTLIGFSKGCVVLNQLLFELKEAKKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLKEFAQTGIIVHTHVTPYQVRDPMRSWIGKEHKKFVQILGDLGMQVTSQIHFTKEAPSIENHFRVHEVF
-
Molecular Weight
69.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C2orf69, also known as chromosome 2 open reading frame 69, is a protein-coding gene located on human chromosome 2. It has garnered interest in the scientific community due to its potential role in various cellular processes and disease mechanisms. Research has indicated that C2orf69 is involved in fundamental biological pathways, including cell cycle regulation and apoptosis, suggesting its significance in maintaining cellular homeostasis. Moreover, recent studies have highlighted its potential association with several diseases, including cancer and neurodegenerative disorders, underscoring the need for comprehensive investigation into its biological functions and interactions. The study of C2orf69 recombinant proteins can facilitate a better understanding of its structural properties and functional roles. By producing and characterizing recombinant C2orf69, researchers aim to elucidate its molecular mechanisms and explore its potential as a therapeutic target. This research is particularly relevant in the context of personalized medicine, where insights into gene function and expression can inform treatment strategies. Overall, the investigation of C2orf69 recombinant proteins represents a promising avenue for advancing our knowledge of this enigmatic gene and its implications for human health and disease.











