Analytical Data
-
Gene name
HECTD3
- Application
-
Alternative Names
E3 ubiquitin-protein ligase HECTD3; HECD3_HUMAN; HECT; HECT domain containing protein 3; HECT domain-containing protein 3; HECTD3; Probable E3 ubiquitin protein ligase HECTD3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T447
-
Expression Region
1-210aa
-
AA Sequence
MEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNFTNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEEKLRYAAYNCVAIDTDMSPWEE
-
Molecular Weight
50.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HECTD3 is a member of the HECT (Homologous to E6-AP Carboxyl Terminus) E3 ubiquitin ligase family, which plays a crucial role in the ubiquitin-proteasome system, responsible for regulating protein degradation and modulating various cellular processes. Research on HECTD3 has gained attention due to its potential involvement in diverse biological functions, including cell proliferation, differentiation, and apoptosis. Abnormalities in ubiquitin ligases like HECTD3 are linked to various diseases, including cancer, neurodegenerative disorders, and developmental abnormalities. The study of HECTD3 recombinant protein allows for the exploration of its specific enzymatic activity and substrate interactions, providing insights into its regulatory mechanisms. Furthermore, understanding the role of HECTD3 in the ubiquitin signaling pathway may reveal novel therapeutic targets for diseases associated with dysregulated protein homeostasis. Recent studies have suggested that HECTD3 may be implicated in cellular stress responses and pathways associated with tumorigenesis, emphasizing the need for further investigation into its molecular function and the implications of its dysregulation in disease contexts. Overall, the characterization of HECTD3 recombinant protein is essential for elucidating its biological roles and potential applications in targeted therapies.
