Cat: PA2000-21DB

Recombinant Human IL12B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL12B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL12B;NKSF2;Interleukin-12 subunit beta

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P29460

  • Expression Region

    23-328aa

  • AA Sequence

    IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSG KTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKE PKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGA ATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYEN YTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLT FCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEW ASVPCS

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-12 beta (IL-12B) is a crucial component of the interleukin-12 (IL-12) cytokine family, playing a vital role in the immune response by regulating T-cell and natural killer (NK) cell activity. It is composed of two subunits, IL-12A and IL-12B, with the latter being essential for the biological activity of the IL-12 heterodimer. Research into IL12B recombinant protein has gained significant attention due to its potential therapeutic applications in various diseases, including cancer, autoimmune disorders, and infectious diseases. The ability of IL-12 to enhance the production of interferon-gamma (IFN-γ) and promote Th1 polarization positions it as a promising agent for immunotherapy. Recombinant IL12B can be utilized not only as a therapeutic protein but also as a research tool to study immune mechanisms and the modulation of host responses to pathogens. The development of recombinant IL12B protocols has opened avenues for investigating its effects on T-cell differentiation and its ability to elicit robust immune responses. Furthermore, studies on polymorphisms in the IL12B gene have highlighted its role in susceptibility to diseases, making it a target for precision medicine approaches. As a result, understanding the structure, function, and regulatory mechanisms of IL12B holds significant potential for developing new strategies to manipulate the immune system for therapeutic benefits. Overall, IL12B recombinant protein research is pivotal in elucidating immune pathways and laying the groundwork for innovative treatments in immunology and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US