Cat: PA1000-1206

Recombinant Human GCAT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GCAT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GCAT;KBL;2-amino-3-ketobutyrate coenzyme A ligase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75600

  • Expression Region

    22-419aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSALAQLRGILEGELEGIRGAGTWKSERVI TSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLS SVRFICGTQSIHKNLEAKIARFHQREDAILYPSCYDANAGLFEALLTPED AVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLEAKLQEAQKHRLRLVA TDGAFSMDGDIAPLQEICCLASRYGALVFMDECHATGFLGPTGRGTDELL GVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPP AVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGASHPICP VMLGDARLASRMADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEED IDRCVEAFVEVGRLHGALP

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of genetically engineered proteins, particularly the GCAT (Glutamate-Cysteine Ligase Catalytic Subunit), has garnered significant interest due to its critical role in cellular functions and disease mechanisms. GCAT is an enzyme involved in the synthesis of glutathione, a vital antioxidant that protects cells from oxidative stress and plays a crucial role in detoxification processes. Research has shown that dysregulation of GCAT can contribute to various health issues, including neurodegenerative diseases, cancer, and metabolic disorders. Scientists are exploring recombinant protein technology to produce GCAT for various applications, including therapeutic interventions and as a tool for studying cellular redox states. By leveraging recombinant DNA technology, researchers aim to understand the enzyme's structure-function relationships, its interactions with other biomolecules, and how it can be manipulated for potential clinical benefits. This research not only enhances the understanding of cellular redox biology but also opens avenues for developing novel strategies to combat diseases linked to oxidative stress, making GCAT a promising target for future biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US