Analytical Data
-
Gene name
TNFaIP6
- Application
-
Alternative Names
TNFaIP6；TSG6；Tumor necrosis factor-inducible gene 6 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P98066
-
Expression Region
1-277aa
-
AA Sequence
MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLT YAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPG PNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPG FPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYD DVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPV SKSSQGKNTSTTSTGNKNFLAGRFSHL
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFaIP6, a protein known as Tumor Necrosis Factor Alpha Induced Protein 6, has gained significant attention in molecular biology and immunology due to its crucial role in various physiological and pathological processes. This protein is primarily involved in the regulation of inflammation and has been linked to conditions such as autoimmune diseases, cancer, and metabolic disorders. Studies show that TNFaIP6 functions as a cytokine that helps modulate the immune response, influencing the activity of macrophages and other immune cells. Understanding its structure and function through recombinant technology has provided insights into its mechanism of action. The ability to produce recombinant TNFaIP6 allows researchers to explore its therapeutic potential, including its impact on inflammatory pathways and its role in immune modulation. This research could pave the way for novel treatments targeting TNFaIP6-related pathways, making it a significant focus in the development of anti-inflammatory therapies and cancer immunotherapies. The ongoing investigation into TNFaIP6 offers valuable knowledge that may contribute to advancements in immunotherapy and the management of inflammation-related diseases.
