Analytical Data
-
Gene name
ITP
- Application
-
Alternative Names
ITP；Integrin beta-1-binding Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UKP3
-
Expression Region
1-347aa
-
AA Sequence
MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE
-
Molecular Weight
38.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ITP (Inosine triphosphate) is a nucleoside triphosphate that plays a crucial role in various cellular processes, including RNA synthesis and nucleotide metabolism. Research into ITP and its related proteins has gained attention due to the significant implications these molecules have in cellular signaling pathways and metabolic regulation. In particular, the study of ITP-restructuring proteins focuses on their ability to modulate the synthesis and degradation of nucleotides, which are essential for energy transfer and signaling in cells. Additionally, abnormalities in nucleotide metabolism and signaling pathways have been linked to various diseases, including cancer and genetic disorders. Understanding how ITP and its associated proteins interact at the molecular level can provide valuable insights into the mechanisms of these diseases and may reveal potential therapeutic targets. Furthermore, the ability to engineer and manipulate these proteins can enhance our understanding of nucleotide biosynthesis and its role in cellular function, paving the way for the development of novel biotechnological applications. Overall, the research on ITP restructuring proteins aims to shed light on their biological significance and to explore their potential in medicine and biotechnology.
