Analytical Data
-
Gene name
HAS3
- Application
-
Alternative Names
HAS3; Hyaluronan synthase 3; Hyaluronate synthase 3; Hyaluronic acid synthase 3; HA synthase 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00219
-
Expression Region
1-281aa
-
AA Sequence
MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ
-
Molecular Weight
56.65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The HAS3 protein, or Hyaluronan Synthase 3, is a critical enzyme involved in the biosynthesis of hyaluronic acid, a glycosaminoglycan that plays a vital role in various physiological processes, including cell proliferation, tissue hydration, and wound healing. Research has shown that HAS3 is particularly important in the context of cancer, as it influences tumor growth, metastasis, and the formation of the tumor microenvironment. Elevated levels of hyaluronic acid, produced by HAS3, have been linked to increased tumor aggressiveness and poor prognosis in several cancer types. Moreover, understanding the regulatory mechanisms governing HAS3 expression and activity can provide insights into novel therapeutic targets for cancer treatment. Investigations into the structure-function relationship of HAS3 and its interactions with other cellular components are essential for unraveling its biological significance. In recent years, the development of recombinant HAS3 protein has facilitated detailed studies on its enzymatic properties, substrate specificity, and potential inhibitors, paving the way for new strategies to modulate hyaluronic acid synthesis in pathological conditions. Overall, research on HAS3 not only enhances our understanding of hyaluronic acid biology but also holds promise for advancing therapeutic interventions in cancer and other diseases characterized by altered glycosaminoglycan metabolism.
