Analytical Data
-
Gene name
HACE1
- Application
-
Alternative Names
HACE1; KIAA1320E3 ubiquitin-protein ligase HACE1; EC 2.3.2.26; HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1; HECT-type E3 ubiquitin transferase HACE1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IYU2
-
Expression Region
800-909aa
-
AA Sequence
TEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HACE1 (HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1) is a crucial component in the ubiquitin-proteasome system that regulates protein degradation and cellular homeostasis. Initially discovered in the context of its potential tumor suppressor role, HACE1 has garnered attention due to its involvement in various biological processes, including cellular stress responses and immune signaling. Dysregulation of HACE1 has been implicated in several diseases, including cancer and neurodegenerative disorders. The study of the recombinant HACE1 protein is essential for elucidating its specific molecular mechanisms and understanding its functional roles in ubiquitination, protein interactions, and pathway regulation. By producing and characterizing recombinant HACE1, researchers aim to investigate its structural properties, substrate specificity, and the impact of post-translational modifications. Furthermore, studying HACE1 in vitro can provide insights into its potential as a therapeutic target and its involvement in disease pathogenesis, paving the way for the development of novel intervention strategies. As research continues to unfold, the exploration of HACE1's role in cellular processes will contribute significantly to our understanding of cellular regulation and its implications in human health.
