Analytical Data
-
Gene name
MYH3
- Application
-
Alternative Names
MYH3；Myosin-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11055
-
Expression Region
2-100aa
-
AA Sequence
SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGK IKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYH3, a member of the myosin heavy chain family, is critically involved in muscle development and function. Mutations in the MYH3 gene have been linked to various congenital myopathies, including nemaline myopathy and congenital fiber type disproportion. These conditions are characterized by abnormal muscle fiber structure and impaired muscle function, often leading to significant morbidity. Research into recombinant MYH3 protein aims to elucidate the mechanistic roles of MYH3 in muscle contraction and disease pathogenesis. By producing MYH3 as a recombinant protein, scientists can study its structural and functional properties in vitro, facilitating a better understanding of the impacts of specific mutations. This research not only enhances our knowledge of MYH3's role in muscle biology but also opens avenues for potential therapeutic strategies targeting myopathies associated with MYH3 dysfunction. Such approaches could lead to the development of novel treatments or gene therapies that address the underlying genetic causes of these debilitating conditions.
