Analytical Data
-
Gene name
MAP3K14
- Application
-
Alternative Names
MAP3K14；NIK；Mitogen-activated Protein kinase kinase kinase 14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99558
-
Expression Region
400-655aa
-
AA Sequence
ATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRAL
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAP3K14, also known as MLK3 (Mixed-Lineage Kinase 3), belongs to the mitogen-activated protein kinase (MAPK) signaling pathway, which plays a crucial role in various cellular processes, including proliferation, differentiation, and apoptosis. Recent studies have highlighted the importance of MAP3K14 in regulating immune responses and inflammatory diseases, positioning it as a potential therapeutic target. The protein functions as a kinase, activating downstream signaling cascades, particularly those involving JNK (c-Jun N-terminal kinase) and p38 MAPK pathways. Given its involvement in cancer progression and resistance to therapy, researchers have focused on generating recombinant MAP3K14 protein to investigate its structure, function, and interactions in detail. By utilizing recombinant protein technology, scientists aim to produce large quantities of MAP3K14, enabling in-depth biochemical assays and structural analyses. These studies can reveal the regulatory mechanisms that control MAP3K14 activity and its role in pathological conditions. Ultimately, understanding MAP3K14's function could lead to the development of novel therapeutic approaches to target tumors and autoimmune disorders, making it a significant focus in both cancer research and immunology.
