Analytical Data
-
Gene name
GADD45G
- Application
-
Alternative Names
GADD45G；CR6；DDIT2;Growth arrest and DNA damage-inducible Protein GADD45 gamma
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95257
-
Expression Region
1-159aa
-
AA Sequence
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
-
Molecular Weight
33.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GADD45G, or Growth Arrest and DNA Damage-inducible gene 45 gamma, is a member of the GADD45 family of proteins, which are crucial for cell growth regulation, DNA repair, and apoptosis. This protein has garnered attention for its role in stress response mechanisms and its potential implications in cancer biology, as it is often upregulated in various cancer types. Research has shown that GADD45G can interact with proteins involved in cell cycle regulation and DNA repair pathways, positioning it as a key player in maintaining genomic stability. The study of recombinant GADD45G proteins allows for a deeper understanding of its functional mechanisms, as well as its interactions with other cellular components. By utilizing recombinant technology, scientists can produce GADD45G in larger quantities, enabling functional assays and structural analyses. This research could facilitate the development of targeted therapies for cancers where GADD45G expression is altered and contribute to the understanding of the molecular pathways involved in tumorigenesis. Given the growing interest in personalized medicine, the investigation of GADD45G could provide insights into biomarkers for cancer diagnosis and prognosis, ultimately paving the way for innovative therapeutic strategies.
