Analytical Data
-
Gene name
H3F3B
- Application
-
Alternative Names
H3 histone family 3A; H3 histone family 3B; H3 histone; family 3B (H3.3B); H3.3; H3.3A; H3.3B; H33_HUMAN; H3F3; H3F3A; H3f3b; Histone H3.3; Histone H3.3Q; Histone H3.A; Histone H3.B; MGC87782; MGC87783
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P84243
-
Expression Region
2-136aa
-
AA Sequence
ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
-
Molecular Weight
42.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H3F3B, one of the histone H3 variants, plays a crucial role in the regulation of gene expression and chromatin dynamics. Unlike canonical histones, H3F3B is incorporated into nucleosomes in a replication-independent manner, making it pivotal in various cellular processes, including differentiation, development, and response to stress. Research into H3F3B has gained traction due to its association with numerous cancers, including glioblastoma and various pediatric tumors, where mutations in its encoding gene can lead to altered cellular functions. Such mutations often result in the replacement of the histone H3 tail, impacting chromatin accessibility and gene regulation. Furthermore, H3F3B is integral to the formation of facultative heterochromatin, thus influencing cellular identity and stability. Studies have also highlighted its involvement in the regulation of key oncogenes and tumor suppressor genes, underscoring its significance in oncogenesis. Given its critical functions and implications in disease, H3F3B continues to be a focal point in epigenetic research, with potential therapeutic strategies aimed at targeting its activity or restoring normal chromatin function in cancerous cells being actively explored. Understanding H3F3B's role within the broader context of the epigenetic landscape could provide insights into novel approaches for cancer treatment and other diseases influenced by chromatin dysregulation.
