Analytical Data
-
Gene name
ZC3H7B
- Application
-
Alternative Names
ZC3H7B；KIAA1031；Zinc finger CCCH domain-containing Protein 7B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UGR2
-
Expression Region
481-915aa
-
AA Sequence
SYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDLLFDPLGGVKRGSLTIAKLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHSFYNNKCLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWLLQQYSGMTHEDIVQESKKYWQQMEAHAGKASSSMGAPRTHGPSTFDLQMKFVCGQCWRNGQVVEPDKDLKYCSAKARHCWTKERRVLLVMSKAKRKWVSVRPLPSIRNFPQQYDLCIHAQNGRKCQYVGNCSFAHSPEERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMMGYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAFRFPMGEFRLCDRLQKGKACPDGDKCRCAHGQEE
-
Molecular Weight
58.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZC3H7B, also known as Zinc Finger CCCH-Type Containing 7B, is a member of the zinc finger protein family that plays a critical role in various biological processes, including regulation of gene expression, RNA processing, and the modulation of immune responses. Emerging evidence suggests that ZC3H7B is involved in cellular growth and differentiation, making it a potential player in developmental biology and oncogenesis. Its unique CCCH-type zinc finger motif allows for specific RNA-binding capabilities, which may influence the stability and translation of target mRNAs. Research has indicated that alterations in ZC3H7B expression or function are associated with several diseases, including cancer and inflammatory disorders. Therefore, the study of ZC3H7B recombinant proteins aims to elucidate their molecular mechanisms, potential interactions with other cellular components, and contributions to disease pathology. Understanding the functional roles and regulatory pathways of ZC3H7B can lead to valuable insights for developing therapeutic strategies targeting conditions linked to its dysregulation. Overall, ZC3H7B serves as a promising focus for ongoing research in molecular biology and translational medicine.
