Analytical Data
-
Gene name
GADD45A
- Application
-
Alternative Names
GADD45A；DDIT1；GADD45；GADD153;Growth arrest and DNA damage-inducible Protein GADD45 alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P24522
-
Expression Region
1-165aa
-
AA Sequence
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
-
Molecular Weight
34.3kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GADD45A (Growth Arrest and DNA Damage-inducible 45 alpha) is a crucial protein that plays a pivotal role in cellular responses to stress, including DNA damage, growth arrest, and apoptosis. Initially identified as a gene upregulated in response to stress signals, GADD45A is involved in various biological processes, such as cell cycle regulation, DNA repair, and inflammation, making it a candidate for studying cancer biology and other diseases. Research has revealed that GADD45A interacts with several key signaling pathways and proteins, including p53, which is known for its role in tumor suppression. Given its involvement in maintaining genomic stability and facilitating various cellular stress responses, GADD45A has gained attention in the context of cancer therapy, where understanding its regulatory mechanisms could lead to novel treatment strategies. The production of recombinant GADD45A protein has enabled researchers to investigate its biochemical properties and functional roles in a controlled environment, providing insights into its mechanism of action and potential therapeutic applications. Studies on recombinant GADD45A are crucial for elucidating how this protein contributes to cellular homeostasis and its implications in pathophysiology, paving the way for future research into targeted therapies for cancer and other diseases associated with cellular stress responses.
