Analytical Data
-
Gene name
GABARAP
- Application
-
Alternative Names
GABARAP；FLC3B;Gamma-aminobutyric acid receptor-associated Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6IAW1
-
Expression Region
1-117aa
-
AA Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYL VPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE EDFFLYIAYSDESVYGL
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GABARAP (GABA receptor-associated protein) is a member of the GABA receptor family that plays a critical role in the regulation of synaptic transmission and cellular signaling within the central nervous system. Its unique function lies in mediating the trafficking and turnover of GABA receptors at postsynaptic sites, thereby influencing neuronal excitability and synaptic plasticity. The research into GABARAP has gained momentum due to its potential implications in various neurological disorders, including epilepsy, schizophrenia, and neurodegenerative diseases. Understanding the structural and functional properties of GABARAP is essential for elucidating its role in cellular mechanisms and for developing targeted therapeutic strategies. Recombinant GABARAP proteins have been generated to study their interactions with GABA receptors and other binding partners, using methods such as site-directed mutagenesis and protein purification. These studies provide valuable insights into the molecular dynamics of GABARAP and its contributions to synaptic function, highlighting its significance in both basic neuroscience and the development of pharmacological interventions. Thus, the investigation of GABARAP recombinant proteins stands at the forefront of neurobiological research aimed at deciphering complex synaptic interactions and their correlations with neurological health and disease.
