Analytical Data
-
Gene name
H1FX
- Application
-
Alternative Names
H1-10. H1FX
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92522
-
Expression Region
1-213aa
-
AA Sequence
MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK
-
Molecular Weight
48.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H1FX, a member of the histone H1 family, plays a crucial role in the structural organization of chromatin and is implicated in the regulation of gene expression. Recent studies have highlighted its significance in various biological processes, including DNA repair, cell cycle regulation, and epigenetic modifications. The reorganization of chromatin by H1FX is vital for maintaining genomic stability and influencing cellular responses to external stimuli. Dysregulation of H1FX expression has been associated with several diseases, including cancer, where altered chromatin structure can lead to aberrant gene expression patterns. Researchers have increasingly focused on the biochemical characterization of H1FX and its interactions with other chromatin-associated proteins to elucidate its precise role in cellular functions. Understanding the dynamics of H1FX and its impact on chromatin architecture provides potential insights into novel therapeutic strategies targeting epigenetic modifications in diseases. As this field of research advances, H1FX is emerging as a key player in both fundamental biology and potential clinical applications.











