Analytical Data
-
Gene name
GTPBP1
- Application
-
Alternative Names
G protein 1; G-protein 1; GP 1; GP-1; GP1; GTP binding protein 1; GTP-binding protein 1; GTPB1_HUMAN; GTPBP1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00178
-
Expression Region
1-584aa
-
AA Sequence
MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKGPLTKRDEGGPSGGPAVGAPPPGDEASSVGAGQPAASSNLQPQPKPSSGGRRRGGQRHKVKSQGACVTPASGC
-
Molecular Weight
89.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GTPBP1, a member of the GTPase superfamily, has garnered attention due to its pivotal role in various cellular processes, including protein synthesis, signal transduction, and cellular stress response. Recent studies have highlighted its involvement in mitochondrial dynamics and cellular aging, suggesting a potential link to age-related diseases. The recombinant protein of GTPBP1 is particularly important for understanding its functional mechanisms at the molecular level. By producing GTPBP1 in a recombinant system, researchers can study its biochemical properties, interaction with other proteins, and its role in cellular pathways more effectively. Furthermore, the exploration of GTPBP1's structure-function relationship is critical, as it may inform therapeutic strategies for diseases associated with mitochondrial dysfunction and cellular stress. Given the upward trend in research focusing on mitochondrial biology and its implications in health and disease, GTPBP1 represents a promising candidate for further investigation, paving the way for potential advancements in therapeutic interventions.
