Cat: PA1000-1136

Recombinant Human FKBP4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FKBP4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FKBP4;FKBP52;Peptidyl-prolyl cis-trans isomerase FKBP4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q02790

  • Expression Region

    1-459aa

  • AA Sequence

    MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIG DRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVG EVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGI IRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDL PYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLK SFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWL EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDS NNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRI RRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAG SQSQVETEALEHHHHHH

  • Molecular Weight

    53 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FKBP4, or FK506-binding protein 4, is a member of the immunophilin family, which plays a crucial role in various cellular processes, including protein folding, trafficking, and the regulation of intracellular signaling pathways. Its significance is highlighted in studies of stress response, immune function, and various diseases, including cancer and neurodegenerative disorders. As a co-chaperone of heat shock proteins, FKBP4 facilitates the maturation and stabilization of client proteins, thereby influencing cellular homeostasis and survival. Research into FKBP4 has gained momentum due to its potential as a therapeutic target; mutations or dysregulation of FKBP4 are associated with several pathologies, making it a candidate for drug development. Moreover, FKBP4 is involved in the modulation of steroid receptor activity, further elucidating its role in hormone signaling and endocrine regulation. The recombination and expression of FKBP4 as a protein offer valuable insights into its structure-function relationships and interactions with other molecular partners. This understanding is essential for developing strategies to modulate its function in disease contexts, emphasizing its relevance in current biomedical research and therapeutic innovations. As such, the study of FKBP4 and its recombinant forms is critical for unveiling its biological roles and potential implications in targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US