Analytical Data
-
Gene name
GTF2H3
- Application
-
Alternative Names
GTF2H3; General transcription factor IIH subunit 3; Basic transcription factor 2 34 kDa subunit; BTF2 p34; General transcription factor IIH polypeptide 3; TFIIH basal transcription factor complex p34 subunit
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13889
-
Expression Region
1-308aa
-
AA Sequence
MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA
-
Molecular Weight
60.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GTF2H3, a pivotal component of the transcription factor IIH (TFIIH) complex, plays a critical role in nucleotide excision repair (NER) and RNA polymerase II transcription. Mutations or dysregulation of GTF2H3 are associated with various disorders, including Xeroderma Pigmentosum (XP), a rare genetic condition characterized by heightened sensitivity to UV radiation and increased cancer risk. The study of GTF2H3 recombinant proteins has gained significant attention as researchers seek to elucidate its function, interactions, and mechanisms of action within cellular pathways. Understanding GTF2H3's role is crucial not only for elucidating the molecular basis of related diseases but also for exploring potential therapeutic avenues for treatment and prevention. Techniques such as protein expression in various host systems, structural characterization using X-ray crystallography or NMR, and functional assays to investigate its enzymatic activity and interactions with other NER components and transcription factors are instrumental in uncovering the multifaceted roles of GTF2H3. This research is vital for advancing our understanding of genomic stability and the intricate processes governing gene expression, with implications for cancer biology and therapeutic intervention.
