Analytical Data
-
Gene name
Z
- Application
-
Alternative Names
Z；Protein S100-Z
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXG8
-
Expression Region
1-99aa
-
AA Sequence
MPTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGK
-
Molecular Weight
11.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Z protein, a key component in various biological processes, has garnered significant interest in the fields of molecular biology and biotechnology. Initially identified in viral studies, Z protein is crucial for viral replication and host interaction, acting as a multifunctional protein that modulates immune responses. Research has demonstrated its role in regulating gene expression and influencing the pathogenesis of certain viral infections. As scientists delve deeper into its structure and function, they have uncovered its potential as a target for therapeutic interventions, particularly in developing antiviral drugs. Furthermore, the Z protein's ability to modulate signaling pathways has opened avenues for exploring its applications in cancer research, where it may contribute to tumor progression and metastasis. Given its pivotal role in both viral and cellular contexts, ongoing studies aim to elucidate the mechanisms by which Z protein exerts its effects, with the hope of harnessing this knowledge for innovative therapeutic strategies.
