Analytical Data
-
Gene name
U69
- Application
-
Alternative Names
U69；Leucine-rich repeat-containing Protein 69
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P24446
-
Expression Region
170-355aa
-
AA Sequence
SEERSYSVVYVPHNKELCGQFCQPEKTMARVLGVGAYGKVFDLDKVAIKTANEDESVISAFIAGVIRAKSGADLLSHECVINNLLISNSVCMSHKVSLSRTYDIDLHKFEDWDVRNVMNYYSVFCKLADAVRFLNLKCRINHFDISPMNIFLNHKKEIIFDAVLADYSLSEMHPNYNGTCAIAKEY
-
Molecular Weight
25.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
U69 is a recombinant protein often studied for its potential applications in various fields, including immunology and vaccine development. Derived from specific viral or bacterial proteins, U69 has gained interest due to its ability to elicit strong immune responses. Research into U69 focuses on understanding its structure-function relationship and how modifications in its recombinant form can enhance its immunogenicity. Studies have shown that U69 can engage various immune cells, leading to the activation of both adaptive and innate immune responses. Furthermore, the production of U69 in expression systems, such as bacteria or yeast, offers a cost-effective means of generating large quantities of the protein for experimental use. As a result, researchers are exploring its potential as a therapeutic agent, particularly in the context of infectious diseases and cancer immunotherapy. The ongoing investigation into U69 not only aims to unravel its biological mechanisms but also seeks to identify its practical applications in designing effective vaccines and treatment strategies.
